PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK36045.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 323aa    MW: 35447.9 Da    PI: 9.5082
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK36045.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.43.2e-08757348
                     SS-HHHHHHHHHHHHHTTTT......-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg......tWktIartmgkgRtlkqcksrwqkyl 48
                      W+ eE++ + +a++++         +W + a++++ +++ +++k ++q +l
       KFK36045.1  7 TWSREEEKSFENAIAMHCVQeeitedQWMKMASMVP-TKSIEEVKKHYQLLL 57
                     7****************999****************.************875 PP

2Myb_DNA-binding38.42.9e-12141185347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
       KFK36045.1 141 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKY 185
                      7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.213361IPR017884SANT domain
SMARTSM007170.0095459IPR001005SANT/Myb domain
PfamPF002497.3E-7756IPR001005SANT/Myb domain
CDDcd001672.96E-6757No hitNo description
SuperFamilySSF466892.55E-8864IPR009057Homeodomain-like
PROSITE profilePS5129417.414134190IPR017930Myb domain
SuperFamilySSF466892.83E-16136191IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-16138188IPR006447Myb domain, plants
SMARTSM007173.0E-10138188IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-11139183IPR009057Homeodomain-like
PfamPF002491.1E-10141185IPR001005SANT/Myb domain
CDDcd001671.47E-9141185No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MESVVMTWSR EEEKSFENAI AMHCVQEEIT EDQWMKMASM VPTKSIEEVK KHYQLLLEDV  60
KAIENGQVPL PRYHHHHHKK LDDTTTSQVN NKDSPSSGGS GSSEKKPNHG GSGISISNGG  120
GGGGGRNGSS RAEQERRKGI PWTEEEHRLF LLGLDKFGKG DWRSISRNFV ISRTPTQVAS  180
HAQKYYIRLT SMNRDRRRSS IHDITTVNNQ AHAVTGQGGQ QQQQQQVVKH RPTISQSQPQ  240
PQPLPHPHQG AAMGGLGMYG GAPMGQPIIV PPDHMGSAVG TPVMLPPPMG THHHHLGVAA  300
PYPVPAYPVP SLPLQHPAPS TMH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-138731173RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00191DAPTransfer from AT1G49010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0160419e-62AC016041.5 Genomic sequence for Arabidopsis thaliana BAC F27J15 from chromosome I, complete sequence.
GenBankAY0869069e-62AY086906.1 Arabidopsis thaliana clone 29302 mRNA, complete sequence.
GenBankAY5195289e-62AY519528.1 Arabidopsis thaliana MYB transcription factor (At1g49010) mRNA, complete cds.
GenBankBT0248629e-62BT024862.1 Arabidopsis thaliana At1g49010 gene, complete cds.
GenBankCP0026849e-62CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009147920.11e-155PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-55DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A087H1P30.0A0A087H1P3_ARAAL; Uncharacterized protein
STRINGBra018772.1-P1e-154(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM103042535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.11e-107MYB family protein